The Equine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL9 Specifications: (Molecular Weight: 12.0 kDa) (Amino Acid Sequence: APVMRKGRCSCIKTSQGTIRPKLLKDLKQFAPSPSCETTEIIATMKNGDQTCLNPDSAEVKELIKEWEKQVSQKKKQKKGKKHQKTKKFPKVKKWQRPRQKKAT) (Gene ID: 100057927). For research use only. Made in the USA