The Equine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL10 Specifications: (Molecular Weight: 9.4 kDa) (Amino Acid Sequence: IPLSRTARCTCINISDRPIPPRSLEKLEMIPASQSCQRVEIIATMKKNGEKRCLNPESKTVKNLLKAISKQRSKRSPRTLREV) (Gene ID: 100050993). For research use only. Made in the USA

Codice: RP0058E-025 | Marca: Kingfisher | Confezionamento:

Note

IP-10