The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). For research use only. Made in the USA

Codice: RP0427D-500 | Marca: Kingfisher | Confezionamento:

Note

IL-1F3

Dettagli prodotto
  • Codice: RP0427D-500
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Protein
  • Simbolo target: IL-1ra