The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). For research use only. Made in the USA

Codice: RPB1827B-010 | Marca: Kingfisher | Confezionamento:

Dettagli prodotto
  • Codice: RPB1827B-010
  • Marca: Kingfisher
  • Confezionamento: Lyophilized
  • Link: Apri link
  • Stoccaggio: -20 C
  • Tipo di campione: Labeled Protein
  • Simbolo target: VEGF-A