The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)) (Gene ID: 112340026). For research use only. Made in the USA

Codice: RP1828BT-025 | Marca: Kingfisher | Confezionamento: