The Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 Receptor Antagonist Biotinylated applications are for cell culture. Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Receptor Antagonist Biotinylated Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514). For research use only. Made in the USA