The Rabbit IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma Biotinylated applications are for cell culture. Rabbit IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144)) (Gene ID: 100008602). For research use only. Made in the USA

Codice: RPB1853U-010 | Marca: Kingfisher | Confezionamento: