The Rabbit sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis Rabbit sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: LHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSD (124)) (Gene ID: 100009412). For research use only. Made in the USA

Codice: RP1858U-100 | Marca: Kingfisher | Confezionamento: