The Bovine IL-16 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 Biotinylated applications are for cell culture. Bovine IL-16 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Biotinylated Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314). For research use only. Made in the USA

Codice: RPB1883B-010 | Marca: Kingfisher | Confezionamento: