The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044). For research use only. Made in the USA