Recombinant Proteins

Descrizione Azione

The Feline IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVLSRISSEL RCQCIKTHST PFNPKLIKEL TVIDSGPHCE NSEIIVKLVN GKEVCLDPKQ KWVQKVVEIF LKKAEKQNA) (Gene ID: 493836). For research use only. Made in the USA

Codice: RP0108F-025
Dettagli

The Feline IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVLSRISSEL RCQCIKTHST PFNPKLIKEL TVIDSGPHCE NSEIIVKLVN GKEVCLDPKQ KWVQKVVEIF LKKAEKQNA) (Gene ID: 493836). For research use only. Made in the USA

Codice: RP0108F-500
Dettagli

The Feline IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVLSRISSEL RCQCIKTHST PFNPKLIKEL TVIDSGPHCE NSEIIVKLVN GKEVCLDPKQ KWVQKVVEIF LKKAEKQNA) (Gene ID: 493836). For research use only. Made in the USA

Codice: RP0108F-005
Dettagli

The Feline IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Feline IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Feline IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVLSRISSEL RCQCIKTHST PFNPKLIKEL TVIDSGPHCE NSEIIVKLVN GKEVCLDPKQ KWVQKVVEIF LKKAEKQNA) (Gene ID: 493836). For research use only. Made in the USA

Codice: RP0108F-100
Dettagli

The Feline LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline LIF applications are for cell culture, ELISA standard, and Western Blot Control. Feline LIF yeast-derived recombinant protein can be purchased in multiple sizes. Feline LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF [Met139Val](180)) (Gene ID: 101090296). For research use only. Made in the USA

Codice: RP1070F-025
Dettagli

The Feline LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline LIF applications are for cell culture, ELISA standard, and Western Blot Control. Feline LIF yeast-derived recombinant protein can be purchased in multiple sizes. Feline LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF [Met139Val](180)) (Gene ID: 101090296). For research use only. Made in the USA

Codice: RP1070F-005
Dettagli

The Feline LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline LIF applications are for cell culture, ELISA standard, and Western Blot Control. Feline LIF yeast-derived recombinant protein can be purchased in multiple sizes. Feline LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF [Met139Val](180)) (Gene ID: 101090296). For research use only. Made in the USA

Codice: RP1070F-500
Dettagli

The Feline LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline LIF applications are for cell culture, ELISA standard, and Western Blot Control. Feline LIF yeast-derived recombinant protein can be purchased in multiple sizes. Feline LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLPITPVNA TCATRHPCHS NLMNQIRNQL AQLNGSANAL FILYYTAQGE PFPNNLDKLC GPNVTDFPPF HANGTEKTRL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATAD IMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVIAVVAQAF [Met139Val](180)) (Gene ID: 101090296). For research use only. Made in the USA

Codice: RP1070F-100
Dettagli

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467). For research use only. Made in the USA

Codice: RP1702F-005
Dettagli

The Feline M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Feline M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Feline M-CSF Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: EEVSERCSHMIGNGHLQFLQQLIDSQMETSCQIAFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFKDNTPNANVIVTLQELSLRLSSCFTKDYEEQDKACVRTFHETPLQLLEKIKNVFNETKNLLKKDWNVFSKNCNKSFEKCSSQGHDRQQEGP (158)) (Gene ID: 101091467). For research use only. Made in the USA

Codice: RP1702F-025
Dettagli

The Feline PDGF-BB yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PDGF-BB applications are for cell culture, ELISA standard, and Western Blot Control. Feline PDGF-BB yeast-derived recombinant protein can be purchased in multiple sizes. Feline PDGF-BB Specifications: (Molecular Weight: 11.9 kDa) (Amino Acid Sequence: EAAGSPTVAE PAMIAECKTR TEVFEVSRRL IDRTNANFLV WPPCVEVQRC SGCCNNRNVQ CRPTQVQLRL VQVRKIEIVR KRPVFKKATV TLEDHLACKC ETVVA (105)) (Gene ID: 100135774). For research use only. Made in the USA

Codice: RP1380F-025
Dettagli

The Feline PDGF-BB yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline PDGF-BB applications are for cell culture, ELISA standard, and Western Blot Control. Feline PDGF-BB yeast-derived recombinant protein can be purchased in multiple sizes. Feline PDGF-BB Specifications: (Molecular Weight: 11.9 kDa) (Amino Acid Sequence: EAAGSPTVAE PAMIAECKTR TEVFEVSRRL IDRTNANFLV WPPCVEVQRC SGCCNNRNVQ CRPTQVQLRL VQVRKIEIVR KRPVFKKATV TLEDHLACKC ETVVA (105)) (Gene ID: 100135774). For research use only. Made in the USA

Codice: RP1380F-005
Dettagli