The Guinea Pig M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig M-CSF Specifications: (Molecular Weight: 26.1 kDa) (Amino Acid Sequence: EEISEHCSHM IGNGHLQALQ HLIDSQMETS CHITFEFADE EQLKDPVCYL KKAFLLVDDI MEDTMRFRDE TPNAKAIIQL QTLSVRLKSC FTKDYEKQDK ACVRTFYETP LQLMEKIKNV FNETKNLLEE DWKIFTKNCS DSFAKCSSPD VVTKPDCNCL YPKATPSSDL ASVSPHQPFI PSKVPKTGLT WADSEGTEGR SLLPNKQLLH TVDPGTAKHR PPRSTCQSLE (230)) (Gene ID: 100732898). For research use only. Made in the USA
The Guinea Pig TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Guinea Pig TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VLSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLL) (Gene ID: 102005158). For research use only. Made in the USA
The Guinea Pig TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TNF alpha Biotinylated applications are for cell culture. Guinea Pig TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TNF alpha Biotinylated Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: SASQNDNDKP VAHVVANQQA EEELQWLSKR ANALLANGMG LSDNQLVVPS DGLYLIYSQV LFKGQGCPSY LLLTHTVSRL AVSYPEKVNL LSAIKSPCQK ETPEGAERKP WYEPIYLGGV FQLQKGDRLS AEVNLPQYLD FADSGQIYFG VIAL (154)) (Gene ID: 100135630). For research use only. Made in the USA
The Guinea Pig TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Guinea Pig TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Guinea Pig TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Guinea Pig TNF alpha Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: SASQNDNDKP VAHVVANQQA EEELQWLSKR ANALLANGMG LSDNQLVVPS DGLYLIYSQV LFKGQGCPSY LLLTHTVSRL AVSYPEKVNL LSAIKSPCQK ETPEGAERKP WYEPIYLGGV FQLQKGDRLS AEVNLPQYLD FADSGQIYFG VIAL (154)) (Gene ID: 100135630). For research use only. Made in the USA
The Hamster CCL16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Hamster CCL16 applications are for cell culture, ELISA standard, and Western Blot Control. Hamster CCL16 yeast-derived recombinant protein can be purchased in multiple sizes. Hamster CCL16 Specifications: (Molecular Weight: 9.7 kDa) (Amino Acid Sequence: LYIRQRMPES IKPLPNCCHK YYEKELPKKR VAGYKEALNC HLPAIIFVTK KNVEVCANPK EEWVKEYIKD PKIPLMPHKN LA (82)) (Gene ID: 106021657). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.