The Mink IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mink IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. Mink IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mink IL-1 alpha Specifications: (Molecular Weight: 18.1 kDa) (Amino Acid Sequence: SAAYNFRSNE KYNYMRIIKS QFILNDNLNQ SIIQQTGGNY LMAAALQNLD DAVKFDMGAY TSEDSKYPVT LRISKTRLFV SAQNEGEPVL LKEMPETPKT IKDETNLLFF WERHGTKNYF TSVAQPKLFI ATQERKLVHM ARGQPSITDF QILETQT (157)) (Gene ID: 122915761). For research use only. Made in the USA
The Mink IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mink IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. Mink IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Mink IL-8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AVLSRVSSEL RCQCIKTHST PFHPKYIKEL RVIDSGPHCE NSEIIVKLVN GKEVCLDPKE DWVQRIVQIF LKKAEKQAS (79)) (Gene ID: 448792). For research use only. Made in the USA
The Mouse and Rat TGF-alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse and Rat TGF-alpha applications are for cell culture, ELISA standard, and Western Blot Control. Mouse and Rat TGF-alpha yeast-derived recombinant protein can be purchased in multiple sizes. Mouse and Rat TGF-alpha Specifications: (Molecular Weight: 5.6 kDa) (Amino Acid Sequence: VVSHFNKCPD SHTQYCFHGT CRFLVQEEKP ACVCHSGYVG VRCEHADLLA (50)) (Gene ID: 21802 (Mouse); 24827 (Rat)). For research use only. Made in the USA
The Mouse Angiogenin-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Angiogenin-1 applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Angiogenin-1 yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Angiogenin-1 Specifications: (Molecular Weight: 13.7 kDa) (Amino Acid Sequence: QDDSRYTKFL TQHHDAKPKG RDDRYCERMM KRRSLTSPCK DVNTFIHGNK SNIKAICGAN GSPYRENLRM SKSPFQVTTC KHTGGSPRPP CQYRASAGFR HVVIACENGL PVHFDESFFS L (121)) (Gene ID: 11727). For research use only. Made in the USA
The Mouse Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Mouse Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Mouse Annexin V Specifications: (Molecular Weight: 35.8 kDa) (Amino Acid Sequence: MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319)) (Gene ID: 11747). For research use only. Made in the USA
The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 69583). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
