Recombinant Proteins

Descrizione Azione

The Swine/Rabbit/Dolphin/Bat IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine/Rabbit/Dolphin/Bat IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Swine/Rabbit/Dolphin/Bat IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Swine/Rabbit/Dolphin/Bat IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: AYRPSETLCG GELVDTLQFV CGDRGFYFSR PASRVNRRSR GIVEECCFRS CDLALLETYC ATPAKSE (67)) (Gene ID: not available). For research use only. Made in the USA

Codice: RP1047-005
Dettagli

The Swine/Rabbit/Dolphin/Bat IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine/Rabbit/Dolphin/Bat IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Swine/Rabbit/Dolphin/Bat IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Swine/Rabbit/Dolphin/Bat IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: AYRPSETLCG GELVDTLQFV CGDRGFYFSR PASRVNRRSR GIVEECCFRS CDLALLETYC ATPAKSE (67)) (Gene ID: not available). For research use only. Made in the USA

Codice: RP1047-025
Dettagli

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676). For research use only. Made in the USA

Codice: RP0151CT-025
Dettagli

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676). For research use only. Made in the USA

Codice: RP0151CT-005
Dettagli

The Multi-species IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. The Multi-species IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IGF-2 Specifications: (Molecular Weight: 7.5 kDa) (Amino Acid Sequence: YGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE (67)) (Gene ID: 100303676). For research use only. Made in the USA

Codice: RP0151CT-100
Dettagli

The Multi-Species IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-Species IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. Multi-Species IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-Species IL-10 Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: SRDASTLSDS SCTHFPASLP HMLRELRAAF GKVKTFFQMK DQLNSMLLTQ SLLDDFKGYL GCQALSEMIQ FYLEEVMPQA ENHGPDIKEH VNSLGEKLKT LRLRLHRCHR FLPCENKSKA VEQVKRVFNM LQERGVYKAM SEFDIFINYI ESYMTTKM (158)) (Gene ID: 443342). For research use only. Made in the USA

Codice: RP2172V-005
Dettagli

The Multi-Species IL-10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-Species IL-10 applications are for cell culture, ELISA standard, and Western Blot Control. Multi-Species IL-10 yeast-derived recombinant protein can be purchased in multiple sizes. Multi-Species IL-10 Specifications: (Molecular Weight: 18.4 kDa) (Amino Acid Sequence: SRDASTLSDS SCTHFPASLP HMLRELRAAF GKVKTFFQMK DQLNSMLLTQ SLLDDFKGYL GCQALSEMIQ FYLEEVMPQA ENHGPDIKEH VNSLGEKLKT LRLRLHRCHR FLPCENKSKA VEQVKRVFNM LQERGVYKAM SEFDIFINYI ESYMTTKM (158)) (Gene ID: 443342). For research use only. Made in the USA

Codice: RP2172V-025
Dettagli

The Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IL-11 (Canine, Feline, Ferret, Mink) applications are for cell culture, ELISA standard, and Western Blot Control. Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IL-11 (Canine, Feline, Ferret, Mink) Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: APGPPPGPPR ASPDPRAELD SAVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LFSYLRHVQW LRRAGGPSLR TLEPELGALQ ARLDRLLRRL QLLMSRLALP QAPPDPPAPP LAPPASAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL (179)) (Gene ID: 101085086 (feline)). For research use only. Made in the USA

Codice: RP2135F-100
Dettagli

The Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IL-11 (Canine, Feline, Ferret, Mink) applications are for cell culture, ELISA standard, and Western Blot Control. Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IL-11 (Canine, Feline, Ferret, Mink) Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: APGPPPGPPR ASPDPRAELD SAVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LFSYLRHVQW LRRAGGPSLR TLEPELGALQ ARLDRLLRRL QLLMSRLALP QAPPDPPAPP LAPPASAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL (179)) (Gene ID: 101085086 (feline)). For research use only. Made in the USA

Codice: RP2135F-025
Dettagli

The Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IL-11 (Canine, Feline, Ferret, Mink) applications are for cell culture, ELISA standard, and Western Blot Control. Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IL-11 (Canine, Feline, Ferret, Mink) Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: APGPPPGPPR ASPDPRAELD SAVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LFSYLRHVQW LRRAGGPSLR TLEPELGALQ ARLDRLLRRL QLLMSRLALP QAPPDPPAPP LAPPASAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL (179)) (Gene ID: 101085086 (feline)). For research use only. Made in the USA

Codice: RP2135F-500
Dettagli

The Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Multi-species IL-11 (Canine, Feline, Ferret, Mink) applications are for cell culture, ELISA standard, and Western Blot Control. Multi-species IL-11 (Canine, Feline, Ferret, Mink) yeast-derived recombinant protein can be purchased in multiple sizes. Multi-species IL-11 (Canine, Feline, Ferret, Mink) Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: APGPPPGPPR ASPDPRAELD SAVLLTRSLL ADTRQLAAQL RDKFPADGDH NLDSLPTLAM SAGALGALQL PGVLTRLRAD LFSYLRHVQW LRRAGGPSLR TLEPELGALQ ARLDRLLRRL QLLMSRLALP QAPPDPPAPP LAPPASAWGG IRAAHAILGG LHLTLDWAVR GLLLLKTRL (179)) (Gene ID: 101085086 (feline)). For research use only. Made in the USA

Codice: RP2135F-005
Dettagli

The Ovine/Caprine IL-12/IL-23 p40 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Ovine/Caprine IL-12/IL-23 p40 applications are for cell culture, ELISA standard, and Western Blot Control. Ovine/Caprine IL-12/IL-23 p40 yeast-derived recombinant protein can be purchased in multiple sizes. Ovine/Caprine IL-12/IL-23 p40 Specifications: (Molecular Weight: 34.5 kDa) (Amino Acid Sequence: IWELEKNVYV VELDWYPNAP GETVVLTCDT PEEDGITWTS DQSSEVLGSG KTLTIQVKEF GDAGQYTCHK GGEVLSRSLL LLHKKEDGIW STDILKDQKE PKAKSFLKCE AKDYSGHFTC SWLTAISTNL KFSVKSSRGS SDPRGVTCGA ASLSAEKVSM DHREYNKYTV ECQEGSACPA AEESLPIEVV MEAVHKLKYE NYTSSFFIRD IIKPDPPKNL QLRPLKNSRQ VEVSWEYPDT WSTPHSYFSL TFCVQVQGKN KREKKLFTDQ TSAKVTCHKD ANIRVQARDR YYSSFWSEWA SVSCS (305)) (Gene ID: 443472). For research use only. Made in the USA

Codice: RP1151V-500
Dettagli