The Rabbit VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit VEGF-A Specifications: (Molecular Weight: 14.2 kDa) (Amino Acid Sequence: APMAEEGDNK PHEVVKFMEV YRRSYCQPIE TLVDIFQEYP DEIEYIFKPS CVPLVRCGGC CNDESLECVP TEEFNVTMQI MRIKPHQGQH IGEMSFLQHN KCECRPKKDR ARQEKCDKPR R (121)) (Gene ID: 100008899). For research use only. Made in the USA
The Rat APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Rat APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Rat APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKQSVLHLVPINITSKADSDMTEVMWQPALRRGRGLEAQGDTVRVRDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIKSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146)) (Gene ID: 287437). For research use only. Made in the USA
The Rat CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. Rat CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL2 Specifications: (Molecular Weight: 14.1 kDa) (Amino Acid Sequence: QPDAVNAPLT CCYSFTGKMI PMSRLENYKR ITSSRCPKEA VVFVTKLKRE ICADPNKEWV QKYIRKLDQN QVRSETTVFY KIASTLRTSA PLNVNLTHKS EANASTLFST TTSSTSVEVT SMTEN (125)) (Gene ID: 24770). For research use only. Made in the USA
The Rat CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rat CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Rat CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Rat CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APIGSDPPTS CCFSYTSRKI HRNFVMDYYE TSSLCSQPAV VFLTKKGRQI CADPSEPWVN EYVNDLELN (69)) (Gene ID: 116637). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
