Recombinant Proteins

Descrizione Azione

The Swine CXCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL13 Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: VLETNDTNLK CQCLRSTSNW VPIRLIEKIQ IWPPGNGCPT REVIVWMTNK TAICLNPQSK LLQKLINLMW RKKTSTTLPA PVSKKSIA (88)) (Gene ID: 100524265). For research use only. Made in the USA

Codice: RP1056S-005
Dettagli

The Swine CXCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. The applications are for Swine CXCL2 are cell culture, ELISA standard, and Western Blot Control. Swine CXCL2 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: APVGGELRCQ CLQTVQGIHL KNIQDLKVTS PGPHCDQTEV IATLKNGQEV CLNPAAPMVK KIIEKMLNKS SAN). For research use only. Made in the USA.

Codice: RP2319S-100
Dettagli

The Swine CXCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. The applications are for Swine CXCL2 are cell culture, ELISA standard, and Western Blot Control. Swine CXCL2 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: APVGGELRCQ CLQTVQGIHL KNIQDLKVTS PGPHCDQTEV IATLKNGQEV CLNPAAPMVK KIIEKMLNKS SAN). For research use only. Made in the USA.

Codice: RP2319S-1000
Dettagli

The Swine CXCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. The applications are for Swine CXCL2 are cell culture, ELISA standard, and Western Blot Control. Swine CXCL2 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: APVGGELRCQ CLQTVQGIHL KNIQDLKVTS PGPHCDQTEV IATLKNGQEV CLNPAAPMVK KIIEKMLNKS SAN). For research use only. Made in the USA.

Codice: RP2319S-025
Dettagli

The Swine CXCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. The applications are for Swine CXCL2 are cell culture, ELISA standard, and Western Blot Control. Swine CXCL2 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: APVGGELRCQ CLQTVQGIHL KNIQDLKVTS PGPHCDQTEV IATLKNGQEV CLNPAAPMVK KIIEKMLNKS SAN). For research use only. Made in the USA.

Codice: RP2319S-005
Dettagli

The Swine CXCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. The applications are for Swine CXCL2 are cell culture, ELISA standard, and Western Blot Control. Swine CXCL2 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: APVGGELRCQ CLQTVQGIHL KNIQDLKVTS PGPHCDQTEV IATLKNGQEV CLNPAAPMVK KIIEKMLNKS SAN). For research use only. Made in the USA.

Codice: RP2319S-500
Dettagli

The Swine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL7 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: AAKIEGRMAH VELRCLCLNT VSGIHPSNIQ SLEVIRAGAH CAKVEVIATL KNDKKICLDP EAPRIKKIVQ KIMEDGGSAA (80)) (Gene ID: 396870). For research use only. Made in the USA

Codice: RP1767S-025
Dettagli

The Swine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL7 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: AAKIEGRMAH VELRCLCLNT VSGIHPSNIQ SLEVIRAGAH CAKVEVIATL KNDKKICLDP EAPRIKKIVQ KIMEDGGSAA (80)) (Gene ID: 396870). For research use only. Made in the USA

Codice: RP1767S-500
Dettagli

The Swine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL7 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: AAKIEGRMAH VELRCLCLNT VSGIHPSNIQ SLEVIRAGAH CAKVEVIATL KNDKKICLDP EAPRIKKIVQ KIMEDGGSAA (80)) (Gene ID: 396870). For research use only. Made in the USA

Codice: RP1767S-100
Dettagli

The Swine CXCL7 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL7 applications are for cell culture, ELISA standard, and Western Blot Control. Swine CXCL7 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL7 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: AAKIEGRMAH VELRCLCLNT VSGIHPSNIQ SLEVIRAGAH CAKVEVIATL KNDKKICLDP EAPRIKKIVQ KIMEDGGSAA (80)) (Gene ID: 396870). For research use only. Made in the USA

Codice: RP1767S-005
Dettagli

The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681). For research use only. Made in the USA

Codice: RP0309S-005
Dettagli

The Swine CXCL9 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine CXCL9 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine CXCL9 yeast-derived recombinant protein can be purchased in multiple sizes. Swine CXCL9 Specifications: (Molecular Weight: 12.1 kDa) (Amino Acid Sequence: TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104)) (Gene ID: 100135681). For research use only. Made in the USA

Codice: RP0309S-025
Dettagli