Recombinant Proteins

Descrizione Azione

The Swine GM-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine GM-CSF applications are for cell culture, ELISA standard, and Western Blot Control. The Swine GM-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Swine GM-CSF Specifications: (Molecular Weight: 14.4 kDa) (Amino Acid Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127)) (Gene ID: 397208). For research use only. Made in the USA

Codice: RP0940S-500
Dettagli

The Swine GM-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine GM-CSF applications are for cell culture, ELISA standard, and Western Blot Control. The Swine GM-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Swine GM-CSF Specifications: (Molecular Weight: 14.4 kDa) (Amino Acid Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127)) (Gene ID: 397208). For research use only. Made in the USA

Codice: RP0940S-100
Dettagli

The Swine GM-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine GM-CSF applications are for cell culture, ELISA standard, and Western Blot Control. The Swine GM-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Swine GM-CSF Specifications: (Molecular Weight: 14.4 kDa) (Amino Acid Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127)) (Gene ID: 397208). For research use only. Made in the USA

Codice: RP0940S-025
Dettagli

The Swine GM-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine GM-CSF applications are for cell culture, ELISA standard, and Western Blot Control. The Swine GM-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Swine GM-CSF Specifications: (Molecular Weight: 14.4 kDa) (Amino Acid Sequence: APTRPPSPVT RPWQHVDAIK EALSLLNNSN DTAAVMNETV DVVCEMFDPQ EPTCVQTRLN LYKQGLRGSL TRLKSPLTLL AKHYEQHCPL TEETSCETQS ITFKSFKDSL NKFLFTIPFD CWGPVKK (127)) (Gene ID: 397208). For research use only. Made in the USA

Codice: RP0940S-005
Dettagli

The Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 Biotinylated applications are for cell culture. Swine IFN alpha 1 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Biotinylated Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFGSPHEAFGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLEACVMQGAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRNLQDRLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA

Codice: RPB1792S-010
Dettagli

The Swine IFN alpha 1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN alpha 1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLA HTRALRLLAQ MRRISPFSCL DHRRDFGSPH EAFGGNQVQK AQAMALVHEM LQQTFQLFST EGSAAAWNES LLHQFCTGLD QQLRDLEACV MQGAGLEGTP LLEEDSILAV RKYFHRLTLY LQEKSYSPCA WEIVRAEVMR SFSSSRNLQD RLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA

Codice: RP0010S-100
Dettagli

The Swine IFN alpha 1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN alpha 1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLA HTRALRLLAQ MRRISPFSCL DHRRDFGSPH EAFGGNQVQK AQAMALVHEM LQQTFQLFST EGSAAAWNES LLHQFCTGLD QQLRDLEACV MQGAGLEGTP LLEEDSILAV RKYFHRLTLY LQEKSYSPCA WEIVRAEVMR SFSSSRNLQD RLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA

Codice: RP0010S-500
Dettagli

The Swine IFN alpha 1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN alpha 1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLA HTRALRLLAQ MRRISPFSCL DHRRDFGSPH EAFGGNQVQK AQAMALVHEM LQQTFQLFST EGSAAAWNES LLHQFCTGLD QQLRDLEACV MQGAGLEGTP LLEEDSILAV RKYFHRLTLY LQEKSYSPCA WEIVRAEVMR SFSSSRNLQD RLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA

Codice: RP0010S-025
Dettagli

The Swine IFN alpha 1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN alpha 1 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN alpha 1 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN alpha 1 Specifications: (Molecular Weight: 19.0 kDa) (Amino Acid Sequence: CDLPQTHSLA HTRALRLLAQ MRRISPFSCL DHRRDFGSPH EAFGGNQVQK AQAMALVHEM LQQTFQLFST EGSAAAWNES LLHQFCTGLD QQLRDLEACV MQGAGLEGTP LLEEDSILAV RKYFHRLTLY LQEKSYSPCA WEIVRAEVMR SFSSSRNLQD RLRKKE (166)) (Gene ID: 397686). For research use only. Made in the USA

Codice: RP0010S-005
Dettagli

The Swine IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN beta Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: SYDVLRYQQR SSNLACQKLL GQLPGTPQYC LEDRMNFEVP EEIMQPPQFQ KEDAVLIIHE MLQQIFGILR RNFSSTGWNE TVIKTILVEL DGQMDDLETI LEEIMEEENF PRGDMTILHL KKYYLSILQY LKSKEYRSCA WTVVQVEILR NFSFLNRLTD YLRN) (Gene ID: 445459). For research use only. Made in the USA

Codice: RP0011S-500
Dettagli

The Swine IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN beta Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: SYDVLRYQQR SSNLACQKLL GQLPGTPQYC LEDRMNFEVP EEIMQPPQFQ KEDAVLIIHE MLQQIFGILR RNFSSTGWNE TVIKTILVEL DGQMDDLETI LEEIMEEENF PRGDMTILHL KKYYLSILQY LKSKEYRSCA WTVVQVEILR NFSFLNRLTD YLRN) (Gene ID: 445459). For research use only. Made in the USA

Codice: RP0011S-100
Dettagli

The Swine IFN beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IFN beta applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IFN beta yeast-derived recombinant protein can be purchased in multiple sizes. Swine IFN beta Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: SYDVLRYQQR SSNLACQKLL GQLPGTPQYC LEDRMNFEVP EEIMQPPQFQ KEDAVLIIHE MLQQIFGILR RNFSSTGWNE TVIKTILVEL DGQMDDLETI LEEIMEEENF PRGDMTILHL KKYYLSILQY LKSKEYRSCA WTVVQVEILR NFSFLNRLTD YLRN) (Gene ID: 445459). For research use only. Made in the USA

Codice: RP0011S-005
Dettagli