The Swine IL-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-3 applications are for cell culture, ELISA standard, and Western Blot Control. Swine IL-3 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-3 Specifications: (Molecular Weight: 13.7 kDa) (Amino Acid Sequence: MPTTTLQPKN YLAMIQEITR SLENLTVTSN KSLTLNELET LVNNTLLRPN LEAFVTFAEN HLKNISGIKK NLEKFRPILP TSMSTEEPIS IEEGDLGDFR AKLMEYLVVL RDSLKPMITE P (121)) (Gene ID: n/a). For research use only. Made in the USA
The Swine IL-4 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-4 Biotinylated applications are for cell culture. Swine IL-4 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-4 Biotinylated Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109)) (Gene ID: 397225). For research use only. Made in the USA
The Swine IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-4 Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109)) (Gene ID: 397225). For research use only. Made in the USA
The Swine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. Swine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-5 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: VENTMNRLVA ETLTLLSIHR TLLIGDGNLM ISTPVHTNHQ LCIEEVFQGI DTLKNQTARG DAVEKLFQNL SLIKEYIDRQ KKNCGGERWR VTQFLDYLQV FLGVINTEWT MES (113)) (Gene ID: 397409). For research use only. Made in the USA
The Swine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-6 Specifications: (Molecular Weight: 20.9 kDa) (Amino Acid Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)) (Gene ID: 399500). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
