The Swine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-6 Specifications: (Molecular Weight: 20.9 kDa) (Amino Acid Sequence: GRLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM (183)) (Gene ID: 399500). For research use only. Made in the USA
The Swine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. Swine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQ (78)) (Gene ID: 396880). For research use only. Made in the USA
The Swine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Swine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-8 Specifications: (Molecular Weight: 9.1 kDa) (Amino Acid Sequence: ARVSAELRCQ CINTHSTPFH PKFIKELRVI ESGPHCENSE IIVKLVNGKE VCLDPKEKWV QKVVQIFLKR TEKQQQQQ (78)) (Gene ID: 396880). For research use only. Made in the USA
The Swine LIF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine LIF applications are for cell culture, ELISA standard, and Western Blot Control. Swine LIF yeast-derived recombinant protein can be purchased in multiple sizes. Swine LIF Specifications: (Molecular Weight: 19.7 kDa) (Amino Acid Sequence: SPLSITPVNA TCATRHPCHS NLMNQIKNQL AQLNSSANAL FILYYTAQGE PFPNNLDKLC GPNVTNFPPF HANGTEKARL VELYRIIAYL GASLGNITRD QRSLNPGAVN LHSKLNATAD SMRGLLSNVL CRLCNKYHVA HVDVAYGPDT SGKDVFQKKK LGCQLLGKYK QVISVLARAF (180)) (Gene ID: 399503). For research use only. Made in the USA
The Swine Midkine yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine Midkine applications are for cell culture, ELISA standard, and Western Blot Control. Swine Midkine yeast-derived recombinant protein can be purchased in multiple sizes. Swine Midkine Specifications: (Molecular Weight: 13.2 kDa) (Amino Acid Sequence: KKKDKVKKGG PGSECAEWTW GPCTPSSKDC GVGFREGTCG AQTQRVRCRV PCNWKKEFGA DCKYKFESWG ACDGGTGTKA RQGTLKKARY NAQCQETIRV TKPCTPKTKA KAKAKKGKGK D (121)) (Gene ID: 100359358). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
