Recombinant Proteins

Descrizione Azione

The Bovine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). For research use only. Made in the USA

Codice: RP0072B-005
Dettagli

The Anole IGF-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-1 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-1 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-1 Specifications: (Molecular Weight: 7.7 kDa) (Amino Acid Sequence: SSETLCGAEL VDALQFVCGE RGFYFSKPAG YGGNRRSVTR GIVDECCFQS CDLTRLEMYC APAKRDKTAR (70)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1675A-100
Dettagli

The Anole IGF-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-1 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-1 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-1 Specifications: (Molecular Weight: 7.7 kDa) (Amino Acid Sequence: SSETLCGAEL VDALQFVCGE RGFYFSKPAG YGGNRRSVTR GIVDECCFQS CDLTRLEMYC APAKRDKTAR (70)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1675A-005
Dettagli

The Anole IGF-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-1 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-1 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-1 Specifications: (Molecular Weight: 7.7 kDa) (Amino Acid Sequence: SSETLCGAEL VDALQFVCGE RGFYFSKPAG YGGNRRSVTR GIVDECCFQS CDLTRLEMYC APAKRDKTAR (70)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1675A-025
Dettagli

The Anole IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-2 Specifications: (Molecular Weight: 7.6 kDa) (Amino Acid Sequence: SHGPAETLCG GELVDTLQFV CGDRGFYFSR PVGRNRGRLN RGIVEECCFR SCDLNLLETY CAKSVKSE (68)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1676A-025
Dettagli

The Anole IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-2 Specifications: (Molecular Weight: 7.6 kDa) (Amino Acid Sequence: SHGPAETLCG GELVDTLQFV CGDRGFYFSR PVGRNRGRLN RGIVEECCFR SCDLNLLETY CAKSVKSE (68)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1676A-005
Dettagli

The Anole IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-2 Specifications: (Molecular Weight: 7.6 kDa) (Amino Acid Sequence: SHGPAETLCG GELVDTLQFV CGDRGFYFSR PVGRNRGRLN RGIVEECCFR SCDLNLLETY CAKSVKSE (68)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1676A-500
Dettagli

The Anole IGF-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Anole IGF-2 applications are for cell culture, ELISA standard, and Western Blot Control. Anole IGF-2 yeast-derived recombinant protein can be purchased in multiple sizes. Anole IGF-2 Specifications: (Molecular Weight: 7.6 kDa) (Amino Acid Sequence: SHGPAETLCG GELVDTLQFV CGDRGFYFSR PVGRNRGRLN RGIVEECCFR SCDLNLLETY CAKSVKSE (68)) (Gene ID: n/a). For research use only. Made in the USA

Codice: RP1676A-100
Dettagli

The Canine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Canine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Canine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKSGKNRRNR KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 475176). For research use only. Made in the USA

Codice: RP1846D-100
Dettagli

The Canine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Canine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Canine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKSGKNRRNR KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 475176). For research use only. Made in the USA

Codice: RP1846D-500
Dettagli

The Canine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Canine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Canine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKSGKNRRNR KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 475176). For research use only. Made in the USA

Codice: RP1846D-005
Dettagli

The Canine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Canine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Canine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKSGKNRRNR KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 475176). For research use only. Made in the USA

Codice: RP1846D-025
Dettagli