The Canine Oncostatin M (OSM) yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Oncostatin M (OSM) applications are for cell culture, ELISA standard, and Western Blot Control. Canine Oncostatin M (OSM) yeast-derived recombinant protein can be purchased in multiple sizes. Canine Oncostatin M (OSM) Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: SCSDKYPELL GQLQKQADFM QHTNTLLDLY IRSQGLDKNG LKEHCRERPG AFPSKDALQR LSRRVFLRTL DTTLGQVLLR LAALEQDIPK AQDLEMLSGV KLNIRGFKNN IHCMAQLLPG SSETTEPTPT SPGASPSPTP TLDTFQRRLE GCRFLHGYHR FMRSVGQVFR EWGKSLSRSR R (181)) (Gene ID: 611921). For research use only. Made in the USA
The Canine PDGF-BB yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine PDGF-BB applications are for cell culture, ELISA standard, and Western Blot Control. Canine PDGF-BB yeast-derived recombinant protein can be purchased in multiple sizes. Canine PDGF-BB Specifications: (Molecular Weight: 12.3 kDa) (Amino Acid Sequence: SLGSPTVAEP AMIAECKTRT EVFEISRRLI DRTNANFLVW PPCVEVQRCS GCCNNRNVQC RPTQVQLRPV QVRKIEIVRK KPTFKKATVT LEDHLACKCE TVVAARPVT (109)) (Gene ID: 442986). For research use only. Made in the USA
The Canine SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF applications are for cell culture, ELISA standard, and Western Blot Control. Canine SCF yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 18.3 kDa) (Amino Acid Sequence: GICGKRVTDD VKDVTKLVAN LPKDYKIALK YVPGMDVLPS HCWISVMVEQ LSVSLTDLLD KFSNISEGLS NYSIIDKLVK IVDDLVECTE GYSFENVKKA PKSPELRLFT PEEFFRIFNR SIDAFKDLET VASKSSECVV SSTLSPDKDS RVSVTKPFML PPVAA (165)) (Gene ID: 403507). For research use only. Made in the USA
The Canine SCF Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine SCF Biotinylated applications are for cell culture. Canine SCF Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Biotinylated Specifications: (Molecular Weight: 27.7 kDa) (Amino Acid Sequence: GICGKRVTDDVKDVTKLVANLPKDYKIALKYVPGMDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSFENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKKKQPNLTRTVENIQINEEDNEISMLQEKEREFQEV (248)) (Gene ID: 403507). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
