The Canine TNFSF11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine TNFSF11 applications are for cell culture, ELISA standard, and Western Blot Control. Canine TNFSF11 yeast-derived recombinant protein can be purchased in multiple sizes. Canine TNFSF11 Specifications: (Molecular Weight: 19.8 kDa) (Amino Acid Sequence: EKAMMEGSWL EMARRGKTHT QPFAHLTINA TDIPSGSHKV SLSSWYHDRG WAKISNMTFS NGKLIVNQDG FYFLYANICF RHHETSGDLA TEYLQLMVYV TKTSIKIPSS HTLMKGGSTK YWSGNSEFHF YSINVGGFFK LRSGEEISIE VSNPSLLDPD QDATYFGAFK VLDID (175)) (Gene ID: 609418). For research use only. Made in the USA
The Canine TWEAK yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine TWEAK applications are for cell culture, ELISA standard, and Western Blot Control. The Canine TWEAK yeast-derived recombinant protein can be purchased in multiple sizes. Canine TWEAK Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: NASKGRKTRA RRAIAAHYEV HPQPGQDGGQ AGVDGTVSGW EEAKINSSNP LRYDRQSGEF IVTRAGLYYL YCQVHFDEGK AVYLKLDLLV DDALALRCLE EFSATAASSL GPQLRLCQVS GLLPLRPGSS LRIRTLPWAH LKAAPFLTYF GLFQVN (156)) (Gene ID: 100568280). For research use only. Made in the USA
The Canine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Canine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Canine SCF Specifications: (Molecular Weight: 22.0 kDa) (Amino Acid Sequence: APMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIRGKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (188)) (Gene ID: 403802). For research use only. Made in the USA
The Canine PD-L1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine PD-L1 applications are for cell culture, ELISA standard, and Western Blot Control. Canine PD-L1 yeast-derived recombinant protein can be purchased in multiple sizes. Canine PD-L1 Specifications: (Molecular Weight: 24.7 kDa) (Amino Acid Sequence: FTITVSKDLY VVEYGGNVTM ECKFPVEKQL NLFALIVYWE MEDKKIIQFV NGKEDLKVQH SSYSQRAQLL KDQLFLGKAA LQITDVRLQD AGVYCCLIGY GGADYKRITL KVHAPYRNIS QRISVDPVTS EHELMCQAEG YPEAEVIWTS SDHRVLSGKT TITNSNREEK LFNVTSTLNI NATANEIFYC TFQRSGPEEN NTAELVIPER LPVPASER (218)) (Gene ID: 484186). For research use only. Made in the USA
The Caprine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Caprine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Caprine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Caprine CCL11 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: QPASIPTICC FNVSRKKISV QRLQSYRKIT GSKCPQKAVI FNTKQNKKIC VDPQEKWVQN AMEYLNQKFQ TLKS (74)) (Gene ID: 102175436). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
