Recombinant Proteins

Descrizione Azione

The Chicken CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL17 Specifications: (Molecular Weight: 8.2 kDa) (Amino Acid Sequence: AAPYAPSECC YEHTKFALRL EALKSFYETS HDCLLQAIVF VTKNGTKVCS KPNAPWVKKA VKYLQKKNNP QAV (73)) (Gene ID: 415652). For research use only. Made in the USA

Codice: RP1859C-025
Dettagli

The Chicken CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL17 Specifications: (Molecular Weight: 8.2 kDa) (Amino Acid Sequence: AAPYAPSECC YEHTKFALRL EALKSFYETS HDCLLQAIVF VTKNGTKVCS KPNAPWVKKA VKYLQKKNNP QAV (73)) (Gene ID: 415652). For research use only. Made in the USA

Codice: RP1859C-005
Dettagli

The Chicken CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL17 Specifications: (Molecular Weight: 8.2 kDa) (Amino Acid Sequence: AAPYAPSECC YEHTKFALRL EALKSFYETS HDCLLQAIVF VTKNGTKVCS KPNAPWVKKA VKYLQKKNNP QAV (73)) (Gene ID: 415652). For research use only. Made in the USA

Codice: RP1859C-100
Dettagli

The Chicken CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL17 Specifications: (Molecular Weight: 8.2 kDa) (Amino Acid Sequence: AAPYAPSECC YEHTKFALRL EALKSFYETS HDCLLQAIVF VTKNGTKVCS KPNAPWVKKA VKYLQKKNNP QAV (73)) (Gene ID: 415652). For research use only. Made in the USA

Codice: RP1859C-500
Dettagli

The Chicken CCL19 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL19 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL19 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL19 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: AGNNVLDCCL RTSEKPIPWR IVQDYRMQLV QDGCDIPATV FITAKGKRLC APPQAPWVLR LREKLDTSSA RKVPNQGN (78)) (Gene ID: 427406). For research use only. Made in the USA

Codice: RP1847C-005
Dettagli

The Chicken CCL19 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL19 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL19 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL19 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: AGNNVLDCCL RTSEKPIPWR IVQDYRMQLV QDGCDIPATV FITAKGKRLC APPQAPWVLR LREKLDTSSA RKVPNQGN (78)) (Gene ID: 427406). For research use only. Made in the USA

Codice: RP1847C-025
Dettagli

The Chicken CCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL1 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: KSFRSSYSSC CYKNMFIQKE INTSLIRRYR ETPPNCSRRA IIVELKKGKK FCVDPAEGWF QQYLQGKKLS NTST (74)) (Gene ID: 395552). For research use only. Made in the USA

Codice: RP2173C-100
Dettagli

The Chicken CCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL1 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: KSFRSSYSSC CYKNMFIQKE INTSLIRRYR ETPPNCSRRA IIVELKKGKK FCVDPAEGWF QQYLQGKKLS NTST (74)) (Gene ID: 395552). For research use only. Made in the USA

Codice: RP2173C-500
Dettagli

The Chicken CCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL1 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: KSFRSSYSSC CYKNMFIQKE INTSLIRRYR ETPPNCSRRA IIVELKKGKK FCVDPAEGWF QQYLQGKKLS NTST (74)) (Gene ID: 395552). For research use only. Made in the USA

Codice: RP2173C-025
Dettagli

The Chicken CCL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL1 applications are for cell culture, ELISA standard, and Western Blot Control. Chicken CCL1 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL1 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: KSFRSSYSSC CYKNMFIQKE INTSLIRRYR ETPPNCSRRA IIVELKKGKK FCVDPAEGWF QQYLQGKKLS NTST (74)) (Gene ID: 395552). For research use only. Made in the USA

Codice: RP2173C-005
Dettagli

The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082). For research use only. Made in the USA

Codice: RP0061C-005
Dettagli

The Chicken CCL20 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL20 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL20 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL20 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: QSNQDCCLSYSKVRLPRKVIKGFTEQLSGEVCDIDAIIFHTVRGLKACVNPKEDWVKKHLLFLSQKLKRMSM) (Gene ID: 395082). For research use only. Made in the USA

Codice: RP0061C-025
Dettagli