The Chicken CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVGSDPPTSCCFTYISRQLPFSFVADYYETNSQCPHAGVVFITRKGREVCANPENDWVQDYMNKMELN) (Gene ID: 395551). For research use only. Made in the USA
The Chicken CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CCL5 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: SPFGADTTVC CFNYSVRKLP QNHVKDYFYT SSKCPQAAVV FITRKGRQVC ANPDARWVKE YINFLELQ (68)) (Gene ID: 417465). For research use only. Made in the USA
The Chicken CD40 Ligand Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CD40 Ligand Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: MHRGHEHPHL KSRNETSVAE EKRQPIATHL AGVKSNTTVR VLKWMTTSYA PTSSLISYHE GKLKVEKAGL YYIYSQVSFC TKAAASAPFT LYIYLYLPME EDRLLMKGLD THSTSTALCE LQSIREGGVF ELRQGDMVFV NVTDSTAVNV NPGNTYFGMF KL (162)) (Gene ID: 395485). For research use only. Made in the USA
The Chicken CX3CL1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken CX3CL1 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken CX3CL1 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken CX3CL1 Specifications: (Molecular Weight: 7.9 kDa) (Amino Acid Sequence: QPRAPLKCSK WCISFHRAID QRQIKSYRET EPQCTKKAII FTTKRNREIC ANPYEPWVEK IVKKLD (66)) (Gene ID: 415651). For research use only. Made in the USA
The Chicken/Duck IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken/Duck IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken/Duck IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken/Duck IL-18 Specifications: (Molecular Weight: 19.5 kDa) (Amino Acid Sequence: AFCKDKTIKR FFRNVNSQLL VVRPDLNVAA FEDVTDQEVK SGSGMYFDIH CYKTTAPSAG MPVAFSVQVE DKSYYMCCEK EHGKMVVRFR EGEVPKDIPG ESNIIFFKKT FTSCSSKAFK FEYSLEQGMF LAFEEEDSLR KLILKKLPRE DEVDETTKFV TSHNERHNL) (Gene ID: 395312). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
