The Chicken SCF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken SCF applications are for cell culture, ELISA standard, and Western Blot Control. Chicken SCF yeast-derived recombinant protein can be purchased in multiple sizes. Chicken SCF Specifications: (Molecular Weight: 22.5 kDa) (Amino Acid Sequence: QSSCGNPVTD DVNDIAKLVG NLPNDYLITL KYVPKMDSLP NHCWLHLMVP EFSRSLHNLL QKFSDISDMS DVLSNYSIIN NLTRIINDLM ACLAFDKNKD FIKENGHLYE EDRFIPENFF RLFNSTIEVY KEFADSLDKN DCIMPSTVET PENDSRVAVT KTISFPPVAA SSLRNDSIGS NTSSNSNKEA LGFISSSSLQ (200)) (Gene ID: 396028). For research use only. Made in the USA
The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
The Chicken TNFSF15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 applications are for cell culture, ELISA standard, and Western Blot Control. The Chicken TNFSF15 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
The Chicken & Turkey VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken & Turkey VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. Rabbit IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Chicken & Turkey VEGF-A Specifications: (Molecular Weight: 19.4 kDa) (Amino Acid Sequence: APALGDGERK PNEVIKFLEV YERSFCRTIE TLVDIFQEYP DEVEYIFRPS CVPLMRCAGC CGDEGLECVP VDVYNVTMEI ARIKPHQSQH IAHMSFLQHS KCDCRPKKDV KNKQENHCEP CSERRKHLFV QDPQTCKCSC KFTDSRCKSR QLELNERTCR CEKPRR (166)) (Gene ID: n/a). For research use only. Made in the USA
The Canine, Equine, Human, Monkey, Ferret, Dolphin, Jamaican fruit-eating Bat CXCL14 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine, Equine, Human, Monkey, Ferret, Dolphin, Jamaican fruit-eating Bat CXCL14 applications are for cell culture, ELISA standard, and Western Blot Control. Canine, Equine, Human, Monkey, Ferret, Dolphin, Jamaican fruit-eating Bat CXCL14 yeast-derived recombinant protein can be purchased in multiple sizes. Canine, Equine, Human, Monkey, Ferret, Dolphin, Jamaican fruit-eating Bat CXCL14 Specifications: (Molecular Weight: 9.4 kDa) (Amino Acid Sequence: SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIITTKS VSRYRGQEHC LHPKLQSTKR FIKWYNAWNE KRRVYEE (77)) (Gene ID: n/a). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
