The Cynomolgus Monkey CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL2 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: QPDAINAPVT CCYNFTNRKI SVQRLASYRR ITSSKCPKEA VIFKTIVAKE ICADPKQKWV QDSMDHLDKQ IQTPKP (76)) (Gene ID: 102135739). For research use only. Made in the USA
The Cynomolgus Monkey CCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL3 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL3 Specifications: (Molecular Weight: 8.3 kDa) (Amino Acid Sequence: NRISATFAAD TPTSCCFSYI SRQIPQNFIA DYFETNSQCS KPGVIFLTKR GRQVCADPSK EWVQKYVSDL ELSA (74)) (Gene ID: 102136134). For research use only. Made in the USA
The Cynomolgus Monkey CCL4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL4 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL4 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL4 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APMGSDPPTS CCFSYTVRKL PRNFVVDYYE TSSLCSQPAV VFQTKRGKQV CADPSETWVQ EYVYDLELN (69)) (Gene ID: 102136805). For research use only. Made in the USA
The Cynomolgus Monkey CCL5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL5 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL5 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL5 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: SPHASDTTPC CFAYIARPLP RAHIKEYFYT SGKCSNPAVV FVTRKNRQVC ANPEKKWVRE YINSLEMS (68)) (Gene ID: 107127795). For research use only. Made in the USA
The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
