Recombinant Proteins

Descrizione Azione

The Cynomolgus Monkey CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CCL8 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPDSVSIPITCCFNVINRKIPIQRLQSYTRITNTQCPKEAVIFKTKWGKEVCADPKERWVRDSMKHLDQMFQNLKP (77)) (Gene ID: 102137164). For research use only. Made in the USA

Codice: RP1877Y-005
Dettagli

The Cynomolgus Monkey CRP yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CRP applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CRP yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CRP Specifications: (Molecular Weight: 23.2 kDa) (Amino Acid Sequence: QTDMSMKAFV FPKESDNSYV TLKARLTKPL KAFTVCLHFY TELSSTRGYS IFSYATKRQN NEILIFWSKD IGYSFTVGGS EILFEVPEVT VAPVHICTSW ESASGIVEFW VDGKPRARKS LKRGYTVGED ASIILGQEQD SFGGSFETQQ SLVGDIGNVN MWDFVLSPDE ISTVYRGGTF SPSVLYWRAL KYEVQGEVFI KPQLWS (206)) (Gene ID: 102126170). For research use only. Made in the USA

Codice: RP2151Y-005
Dettagli

The Cynomolgus Monkey CRP yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CRP applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CRP yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CRP Specifications: (Molecular Weight: 23.2 kDa) (Amino Acid Sequence: QTDMSMKAFV FPKESDNSYV TLKARLTKPL KAFTVCLHFY TELSSTRGYS IFSYATKRQN NEILIFWSKD IGYSFTVGGS EILFEVPEVT VAPVHICTSW ESASGIVEFW VDGKPRARKS LKRGYTVGED ASIILGQEQD SFGGSFETQQ SLVGDIGNVN MWDFVLSPDE ISTVYRGGTF SPSVLYWRAL KYEVQGEVFI KPQLWS (206)) (Gene ID: 102126170). For research use only. Made in the USA

Codice: RP2151Y-025
Dettagli

The Cynomolgus Monkey sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: KAMHVAQPAV VLANSRGIAS FVCEYASPGK ATEVRVTVLR QADSQVTEVC AATYMMGNEL TFLDDSICTG TSSGNQVNLT IQGLRAMDTG LYICKVELMY PPPYYMGIGN GTQIYVIDPE PCPDSD (126)) (Gene ID: 102115124). For research use only. Made in the USA

Codice: RP1775Y-025
Dettagli

The Cynomolgus Monkey sCTLA-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey sCTLA-4 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey sCTLA-4 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey sCTLA-4 Specifications: (Molecular Weight: 13.5 kDa) (Amino Acid Sequence: KAMHVAQPAV VLANSRGIAS FVCEYASPGK ATEVRVTVLR QADSQVTEVC AATYMMGNEL TFLDDSICTG TSSGNQVNLT IQGLRAMDTG LYICKVELMY PPPYYMGIGN GTQIYVIDPE PCPDSD (126)) (Gene ID: 102115124). For research use only. Made in the USA

Codice: RP1775Y-005
Dettagli

The Cynomolgus Monkey CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL10 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP (77)) (Gene ID: 102134351). For research use only. Made in the USA

Codice: RP1181Y-100
Dettagli

The Cynomolgus Monkey CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL10 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP (77)) (Gene ID: 102134351). For research use only. Made in the USA

Codice: RP1181Y-500
Dettagli

The Cynomolgus Monkey CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL10 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP (77)) (Gene ID: 102134351). For research use only. Made in the USA

Codice: RP1181Y-005
Dettagli

The Cynomolgus Monkey CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL10 Specifications: (Molecular Weight: 8.7 kDa) (Amino Acid Sequence: IPLSRTVRCT CISISNQPVN PRSLEKLEII PPSQFCPHVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK ERSKRSP (77)) (Gene ID: 102134351). For research use only. Made in the USA

Codice: RP1181Y-025
Dettagli

The Cynomolgus Monkey CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL11 Specifications: (Molecular Weight:7.5 kDa) (Amino Acid Sequence:GRCLCIGPGV KAVKVADIEK ASIIYPSNNC DKIEVIITLK ENKGQRCLNP KSKQARLIIK KVERKNF). For research use only. Made in the USA

Codice: RP2231Y-500
Dettagli

The Cynomolgus Monkey CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL11 Specifications: (Molecular Weight:7.5 kDa) (Amino Acid Sequence:GRCLCIGPGV KAVKVADIEK ASIIYPSNNC DKIEVIITLK ENKGQRCLNP KSKQARLIIK KVERKNF). For research use only. Made in the USA

Codice: RP2231Y-100
Dettagli

The Cynomolgus Monkey CXCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Cynomolgus Monkey CXCL11 applications are for cell culture, ELISA standard, and Western Blot Control. Cynomolgus Monkey CXCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Cynomolgus Monkey CXCL11 Specifications: (Molecular Weight:7.5 kDa) (Amino Acid Sequence:GRCLCIGPGV KAVKVADIEK ASIIYPSNNC DKIEVIITLK ENKGQRCLNP KSKQARLIIK KVERKNF). For research use only. Made in the USA

Codice: RP2231Y-025
Dettagli