Recombinant Proteins

Recombinant Proteins

Descrizione	Azione
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA Egyptian Rousette Bat M-CSF Recombinant Protein Codice: RP1916BT-500	Dettagli
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA Egyptian Rousette Bat M-CSF Recombinant Protein Codice: RP1916BT-100	Dettagli
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA Egyptian Rousette Bat M-CSF Recombinant Protein Codice: RP1916BT-025	Dettagli
The Egyptian Rousette Bat M-CSF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat M-CSF applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat M-CSF yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat M-CSF Specifications: (Molecular Weight: 18.8 kDa) (Amino Acid Sequence: KEESKHCSYMIGDGHLQLLQQLIDSQMETSCPISFEFVDKERLKDPVCYVKKAFFLVQEIMEDTVRFKDNTSNAHAILKLQELSVSLEACFPKDFEEKDKACVGNFSESPLQLLEKIKNFFNETKNLLKKDRNIFSKNCSNTFAQCSSQSHKPERLEPWPHG (162)) (Gene ID: 107516132). For research use only. Made in the USA Egyptian Rousette Bat M-CSF Recombinant Protein Codice: RP1916BT-005	Dettagli
The Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat TIM-3 Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYVVEVGQNA YLPCSYMPAT SEDLVPVCWG KGSCPAFQCH SMVLNTDGRN VNYRTSRRYQ LKGNIHKGDV SLTIENVTLA DSGIYCCRIQ FSGPMNDEKS NLRLEVNPAK VTPAWTTRRD ITAAFPRLLT TEGHDSETQS METFHDRNHT QISTSANELQ DSGATTRI (168)) (Gene ID: 107521924). For research use only. Made in the USA Egyptian Rousette Bat TIM-3 Recombinant Protein Codice: RP2164BT-100	Dettagli
The Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat TIM-3 Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYVVEVGQNA YLPCSYMPAT SEDLVPVCWG KGSCPAFQCH SMVLNTDGRN VNYRTSRRYQ LKGNIHKGDV SLTIENVTLA DSGIYCCRIQ FSGPMNDEKS NLRLEVNPAK VTPAWTTRRD ITAAFPRLLT TEGHDSETQS METFHDRNHT QISTSANELQ DSGATTRI (168)) (Gene ID: 107521924). For research use only. Made in the USA Egyptian Rousette Bat TIM-3 Recombinant Protein Codice: RP2164BT-025	Dettagli
The Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat TIM-3 Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYVVEVGQNA YLPCSYMPAT SEDLVPVCWG KGSCPAFQCH SMVLNTDGRN VNYRTSRRYQ LKGNIHKGDV SLTIENVTLA DSGIYCCRIQ FSGPMNDEKS NLRLEVNPAK VTPAWTTRRD ITAAFPRLLT TEGHDSETQS METFHDRNHT QISTSANELQ DSGATTRI (168)) (Gene ID: 107521924). For research use only. Made in the USA Egyptian Rousette Bat TIM-3 Recombinant Protein Codice: RP2164BT-005	Dettagli
The Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Egyptian Rousette Bat TIM-3 applications are for cell culture, ELISA standard, and Western Blot Control. Egyptian Rousette Bat TIM-3 yeast-derived recombinant protein can be purchased in multiple sizes. Egyptian Rousette Bat TIM-3 Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: SYVVEVGQNA YLPCSYMPAT SEDLVPVCWG KGSCPAFQCH SMVLNTDGRN VNYRTSRRYQ LKGNIHKGDV SLTIENVTLA DSGIYCCRIQ FSGPMNDEKS NLRLEVNPAK VTPAWTTRRD ITAAFPRLLT TEGHDSETQS METFHDRNHT QISTSANELQ DSGATTRI (168)) (Gene ID: 107521924). For research use only. Made in the USA Egyptian Rousette Bat TIM-3 Recombinant Protein Codice: RP2164BT-500	Dettagli
The Equine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Equine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Equine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SIRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNK KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 100050528). For research use only. Made in the USA Equine Amphiregulin Recombinant Protein Codice: RP1705E-005	Dettagli
The Equine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Equine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Equine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SIRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNK KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 100050528). For research use only. Made in the USA Equine Amphiregulin Recombinant Protein Codice: RP1705E-025	Dettagli
The Equine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Equine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Equine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SIRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNK KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 100050528). For research use only. Made in the USA Equine Amphiregulin Recombinant Protein Codice: RP1705E-100	Dettagli
The Equine Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Equine Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Equine Amphiregulin Specifications: (Molecular Weight: 10.1 kDa) (Amino Acid Sequence: SIRVEQVVKP KKNKTESEKT SDKPKRKKKG GKNGKNRRNK KKKNPCDAEF QNFCIHGECK YIEHLEAVTC QCHQDYFGER CGEKSMK (87)) (Gene ID: 100050528). For research use only. Made in the USA Equine Amphiregulin Recombinant Protein Codice: RP1705E-500	Dettagli

1…82 83 848586 87 88…228

Marca

Conservazione

Tipo di campione

Confezionamento (campo)

Simbolo target

Reset

2025 TEMA Ricerca - All Rights Reserved.