Recombinant Proteins

Descrizione Azione

Annexins are important in various cellular and physiological processes such as providing a membrane scaffold, which is relevant to changes in the physical shape of the cell. Annexin proteins have been shown to be involved in trafficking and organization of vesicles, exocytosis, endocytosis and also calcium ion channel formation. Annexin proteins are not exclusively intracellular protein: Annexin proteins are also found in the extracellular space and have been linked to several processes fibrinolysis, coagulation, inflammation and apoptosis. Annexin proteins are all capable of binding negatively charged phospholipids in a calcium dependent manner and contain a 70 amino acid repeat sequence called an annexin repeat. Equine Annexin V Fluorescein has a predicted molecular weight of 36.0 kDa. Protein Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321). Made in the USA

Codice: RPF0965E-010
Dettagli

The Equine Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Equine Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Equine Annexin V Specifications: (Molecular Weight: 36.0 kDa) (Amino Acid Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321)) (Gene ID: 100072241). For research use only. Made in the USA

Codice: RP1797E-500
Dettagli

The Equine Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Equine Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Equine Annexin V Specifications: (Molecular Weight: 36.0 kDa) (Amino Acid Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321)) (Gene ID: 100072241). For research use only. Made in the USA

Codice: RP1797E-025
Dettagli

The Equine Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Equine Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Equine Annexin V Specifications: (Molecular Weight: 36.0 kDa) (Amino Acid Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321)) (Gene ID: 100072241). For research use only. Made in the USA

Codice: RP1797E-005
Dettagli

The Equine Annexin V yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Annexin V applications are for cell culture, ELISA standard, and Western Blot Control. Equine Annexin V yeast-derived recombinant protein can be purchased in multiple sizes. Equine Annexin V Specifications: (Molecular Weight: 36.0 kDa) (Amino Acid Sequence: MAQVLKGTVT DFPGFDERAD AEVLRKAMKG LGTDEESILT LLTSRSNAQR QEIAVAFKTL FGRDLLDDLK SELTGKFEKL IVALMKPSRL YDAYELKHAL KGAGTNEKVL TEIIASRTPA ELRAIKQVYE EEYGSNLEDD VVADTSGFYQ RMLVVLLQAN RDPDAGIDEA QVEQDAQTLF QAGELKWGTD EEKFITIFGT RSVSHLRRVF DKYMTISGFQ IEETIDRETS GNLEQLLLAV VKSIRSIPAY LAETLYYAMK GAGTDDHTLI RVVVSRSEID LFNIRKEFRK NFATSLYSMI KSDTSGDYKK ALLLLCGGED D (321)) (Gene ID: 100072241). For research use only. Made in the USA

Codice: RP1797E-100
Dettagli

The Equine BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Equine BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Equine BAFF Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: AAQDSEEAVT QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGKALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVTLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISRD GDGTFFGALK LL (152)) (Gene ID: 100051550). For research use only. Made in the USA

Codice: RP0904E-025
Dettagli

The Equine BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine BAFF applications are for cell culture, ELISA standard, and Western Blot Control. The Equine BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Equine BAFF Specifications: (Molecular Weight: 17.0 kDa) (Amino Acid Sequence: AAQDSEEAVT QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGKALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVTLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISRD GDGTFFGALK LL (152)) (Gene ID: 100051550). For research use only. Made in the USA

Codice: RP0904E-005
Dettagli

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949). For research use only. Made in the USA

Codice: RP0066E-005
Dettagli

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949). For research use only. Made in the USA

Codice: RP0066E-100
Dettagli

The Equine CCL11 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL11 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL11 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL11 Specifications: (Molecular Weight: 9.0 kDa) (Amino Acid Sequence: AQPVSISTVCCFNVASRKISFQRLQSYRKITSSKCPQKAVIFKTKQAKKICADPKQKWVQDAMKYLDENSRTTKYSSF) (Gene ID: 100033949). For research use only. Made in the USA

Codice: RP0066E-025
Dettagli

The Equine CCL2 (MCP-1) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL2 (MCP-1) Biotinylated applications are for cell culture. Equine CCL2 (MCP-1) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL2 (MCP-1) Biotinylated Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTFTGKKI SSQRLGSYKR VTSSKCPKEA VIFKTILAKE ICADPEQKWV QDAVKQLDKK AQTPKP) (Gene ID: 100034136). For research use only. Made in the USA

Codice: RPB1816E-010
Dettagli

The Equine CCL2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL2 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CCL2 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL2 Specifications: (Molecular Weight: 8.5 kDa) (Amino Acid Sequence: QPDAINSPVT CCYTFTGKKI SSQRLGSYKR VTSSKCPKEA VIFKTILAKE ICADPEQKWV QDAVKQLDKK AQTPKP) (Gene ID: 100034136). For research use only. Made in the USA

Codice: RP0054E-500
Dettagli