Recombinant Proteins

Descrizione Azione

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA

Codice: RP0102E-500
Dettagli

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA

Codice: RP0102E-005
Dettagli

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA

Codice: RP0102E-025
Dettagli

The Equine IL-13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-13 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-13 Specifications: (Molecular Weight: 12.6 kDa) (Amino Acid Sequence: SPAPLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA) (Gene ID: 100034113). For research use only. Made in the USA

Codice: RP0102E-100
Dettagli

The Equine IL-15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-15 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-15 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-15 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: NWQDVISDLK RIEDLIQSIH VDATLYTESD AHPNCKVTAM KCFLLELHVI SHESRNEDIK ETVENLIILA NSSLSSNGNV TESGCKECEE LEEKNIKEFL QSFVHIVQMF INPS (114)) (Gene ID: 100034058). For research use only. Made in the USA

Codice: RP0044E-025
Dettagli

The Equine IL-15 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-15 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-15 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-15 Specifications: (Molecular Weight: 13.0 kDa) (Amino Acid Sequence: NWQDVISDLK RIEDLIQSIH VDATLYTESD AHPNCKVTAM KCFLLELHVI SHESRNEDIK ETVENLIILA NSSLSSNGNV TESGCKECEE LEEKNIKEFL QSFVHIVQMF INPS (114)) (Gene ID: 100034058). For research use only. Made in the USA

Codice: RP0044E-005
Dettagli

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA

Codice: RP0078E-500
Dettagli

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA

Codice: RP0078E-100
Dettagli

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA

Codice: RP0078E-025
Dettagli

The Equine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-17A Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: GIVIPQNPECPNTGDKNFPQNVKINLNVLNRKTNSRRASDYHNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKVDFHMNSVPIQQEILVLRRESQNCPHSFQLEKMLVAVGCTCVTPIVRHMG) (Gene ID: 100034142). For research use only. Made in the USA

Codice: RP0078E-005
Dettagli

The Equine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-18 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence:YFGRLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCTD NAPQTVFIIY MYKDSLTRGL AVTISVKCEK TSTLSCKNKI ISFKEMSPPE NINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE NDLFKLILKE KDENGDKSVM FTVQNQN). For research use only. Made in the USA

Codice: RP2218E-025
Dettagli

The Equine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. Equine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-18 Specifications: (Molecular Weight: 18.0 kDa) (Amino Acid Sequence:YFGRLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCTD NAPQTVFIIY MYKDSLTRGL AVTISVKCEK TSTLSCKNKI ISFKEMSPPE NINDEGNDII FFQRSVPGHD DKIQFESSLY KGYFLACEKE NDLFKLILKE KDENGDKSVM FTVQNQN). For research use only. Made in the USA

Codice: RP2218E-100
Dettagli