The Equine IL-4 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-4 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-4 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-4 Specifications: (Molecular Weight: 12.8 kda) (Amino Acid Sequence: GCKYDITLQE IIKTLNNLTD GKGKNSCMEL TVADAFAGPK NTDGKEICRA AKVLQQLYKR HDRSLIKECL SGLDRNLKGM ANGTCCTVNE AKKSTLKDFL ERLKTIMKEK YSKC (114)) (Gene ID: 100034225). For research use only. Made in the USA
The Equine IL-5 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 Biotinylated applications are for cell culture. Equine IL-5 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Biotinylated Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199). For research use only. Made in the USA
The Equine IL-5 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-5 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199). For research use only. Made in the USA
The Equine IL-6 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-6 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-6 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-6 Specifications: (Molecular Weight: 20.6 kDa) (Amino Acid Sequence: TPLPLGEDET TSNGPLLTTA DKTKQHIKYI LGKISALKNE MCNNFSKCEN SKEVLAENNL NLPKMAEKDG CFQSGFNQET CLMKITTGLS EFQIYLEYLQ NEFKGEKENI KTMQISTKVL VQILMQKMKN PEVTTPDPTA KSSLLAKLHS QNEWLKNTTT HLILRSLEDF LQFSLRAVRI M) (Gene ID: 100034196). For research use only. Made in the USA
The Equine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-8 Specifications: (Molecular Weight: 8.9 kDa) (Amino Acid Sequence: AVVSRITAELRCQCIKTHSKPFNPKLIKEMRVIESGPHCENSEIIVKLVNGAEVCLNPHTKWVQIIVQAFLKRAEGQNP (79)) (Gene ID: 100037400). For research use only. Made in the USA
The Equine Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Equine Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Equine Leukemia Inhibitory Factor Specifications: (Molecular Weight: 21.3 kDa) (Amino Acid Sequence: SPLPITPDNA TCATRHPCHS NLMDQIRNQL VQLNSSANAL FILYYTAQGE PFPSNLDKLC RPDVTDFPPF HANGKEKARL VELYRIIAYL GASLGNITRD QKVLNPNALS LHSKLNATSD TMRGLLSNVL CHLCSKYHVA NVDVAYGPDT SNKDVFQKKK LGCQLLGKYK QVIAVVAQAF QTGDLEAYSD PRS (193)) (Gene ID: 100629131). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
