Recombinant Proteins

Descrizione Azione

The Equine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Equine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 100033839). For research use only. Made in the USA

Codice: RP0341E-005
Dettagli

The Equine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Equine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Equine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGEHKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTAEFNITMQIMRIKPHQSQHIGEMSFLQHSKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR (164)) (Gene ID: 100033839). For research use only. Made in the USA

Codice: RP0341E-025
Dettagli

The Feline Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Feline Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Feline Amphiregulin Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKNGKNRKNR KKKNPCDAEF QNFCIHGECK YIENLGAVTC KCHQDYFGER CGEKSMK (87)) (Gene ID: 101081041). For research use only. Made in the USA

Codice: RP1580F-005
Dettagli

The Feline Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Feline Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Feline Amphiregulin Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKNGKNRKNR KKKNPCDAEF QNFCIHGECK YIENLGAVTC KCHQDYFGER CGEKSMK (87)) (Gene ID: 101081041). For research use only. Made in the USA

Codice: RP1580F-100
Dettagli

The Feline Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Feline Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Feline Amphiregulin Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKNGKNRKNR KKKNPCDAEF QNFCIHGECK YIENLGAVTC KCHQDYFGER CGEKSMK (87)) (Gene ID: 101081041). For research use only. Made in the USA

Codice: RP1580F-025
Dettagli

The Feline Amphiregulin yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline Amphiregulin applications are for cell culture, ELISA standard, and Western Blot Control. Feline Amphiregulin yeast-derived recombinant protein can be purchased in multiple sizes. Feline Amphiregulin Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: SVRVEQVVKP MKNKTESEKT SDKPKRKKKG GKNGKNRKNR KKKNPCDAEF QNFCIHGECK YIENLGAVTC KCHQDYFGER CGEKSMK (87)) (Gene ID: 101081041). For research use only. Made in the USA

Codice: RP1580F-500
Dettagli

The Feline Angiogenin-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline Angiogenin-1 applications are for cell culture, ELISA standard, and Western Blot Control. Feline Angiogenin-1 yeast-derived recombinant protein can be purchased in multiple sizes. Feline Angiogenin-1 Specifications: (Molecular Weight: 14.0 kDa) (Amino Acid Sequence: QDDSRYKHFL TQHYDAKPKG RNDRYCESMM ERRGLTTPCK DTNTFIHGNK GSIKAICGNK NGNPYREALR LSKSPFQITT CRHVGGSPRP PCRYRATPGF RHIAVACENG LPVHFDESFF RP (122)) (Gene ID: 101082240). For research use only. Made in the USA

Codice: RP1410F-005
Dettagli

The Feline BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline BAFF applications are for cell culture, ELISA standard, and Western Blot Control. Feline BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Feline BAFF Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: AALDPEDTVI QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGRALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVNLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISQD GDGTFFGALK LL (152)) (Gene ID: 101088640). For research use only. Made in the USA

Codice: RP1098F-025
Dettagli

The Feline BAFF yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline BAFF applications are for cell culture, ELISA standard, and Western Blot Control. Feline BAFF yeast-derived recombinant protein can be purchased in multiple sizes. Feline BAFF Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: AALDPEDTVI QDCLQLIADS DTPTIRKGAY TFVPWLLSFK RGRALEEKEN KILVKETGYF FIYGQVLYTD NTFAMGHLIQ RKKVHVFGDE LSLVNLFRCI QNMPETLPNN SCYSAGIAKL EEGDELQLAI PREDAKISQD GDGTFFGALK LL (152)) (Gene ID: 101088640). For research use only. Made in the USA

Codice: RP1098F-005
Dettagli

The Feline CCL14 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL14 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL14 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: SSRGPYHPAE CCFNYIAQAI ARHRITGYYE TSSQCSRPGV VFITKKGHSI CANPSDVWVQ DYIKDLEEK). For research use only.

Codice: RP2614F-005
Dettagli

The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1990F-025
Dettagli

The Feline CCL17 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Feline CCL17 applications are for cell culture, ELISA standard, and Western Blot Control. Feline CCL17 yeast-derived recombinant protein can be purchased in multiple sizes. Feline CCL17 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: VLSGALCFRM KDAELKVLYL HDNQLLAGRL HAGNIIQGEE ISVVPNRSLD AKLSPVILGV QGGSQCLSCG TGQEPTLKLE PVNIMELYLG AKESKSFTFY RRDTGLTSSF ESAAYPGWFL CTVPEADQPL RLTQLSEDAS WDSPITDFYF QQCD (154)) (Gene ID: 101097230). For research use only. Made in the USA

Codice: RP1990F-005
Dettagli