The Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common Vampire Bat IFN lambda 3 applications are for cell culture, ELISA standard, and Western Blot Control. Common Vampire Bat IFN lambda 3 yeast-derived recombinant protein can be purchased in multiple sizes. Common Vampire Bat IFN lambda 3 Specifications: (Molecular Weight: 23.4 kDa) (Amino Acid Sequence: PPPLLTLSMP SLVSPSINTD LPVGCTLVLM LMTTVLTRTA AVPVPTPLSA LPGARGCVVA QFKFLAPQDMKAFRRAKDTLEELLLPKNRSCSSRPFPRTRDLRQLQVWERPVALEAELALTLKVLGSIANSTLGDILDQPLHMLRYIHTKLQACVPAQATAGPRPRGHLHHWLHRLQEASKKESTGCLEASVTFNLFRLLTHDLQCVASGGLCI (214)) (Gene ID: 112340026). For research use only. Made in the USA
The Common Vampire Bat IL-22 ELISA contains capture antibody, recombinant protein standard, and detection antibody for development of a Common Vampire Bat IL-22 ELISA. The antibodies have been determined to function in an ELISA with the standard provided. Optimal buffers, concentrations, incubation times, incubation temperatures, and methods for the ELISA have not been determined. This allows for complete flexibility to provide optimal dynamic range and sensitivity based on your sample type. Alternate names include IL-22, IL-D110, IL-TIF, ILTIF, TIFIL-23, TIFa, zcyto18, interleukin 22. The quantities of components provided are not matched. Components may also be purchased separately. For research use only. Made in the USA
The Common Vampire Bat IL-22 polyclonal antibody is unlabeled and has been qualified for use in ELISA and Western blot applications. It is the capture antibody in the Kingfisher Common Vampire Bat IL-22 ELISA. The Common Vampire Bat IL-22 antibody was produced in rabbits and is antigen-affinity purified. The reactivity by species is: (Common vampire bat IL-22 - Strong) (Bovine IL-22 - None) (Caprine IL-22 - None) (Chicken IL-22 - None) (Cynomolgus monkey IL-22 - None) (Ferret IL-22 - None) (Mouse IL-22 - None) (Ovine IL-22 - None) (Rabbit IL-22 - None) (Swine IL-22 - None). For research use only. Made in the USA
The Common Vampire Bat IL-22 polyclonal antibody is labeled and has been qualified for use in ELISA. It is the detection antibody in the Kingfisher Common Vampire Bat IL-22 ELISA. The Common Vampire Bat IL-22 antibody was produced in rabbits and is antigen-affinity purified. The reactivity by species is: (Common vampire bat IL-22 - Strong) (Bovine IL-22 - None) (Caprine IL-22 - None) (Chicken IL-22 - None) (Cynomolgus monkey IL-22 - None) (Ferret IL-22 - None) (Mouse IL-22 - None) (Ovine IL-22 - None) (Rabbit IL-22 - None) (Swine IL-22 - None). For research use only. Made in the USA
The Common vampire Bat IL-22 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Common vampire Bat IL-22 applications are for cell culture, ELISA standard, and Western Blot Control. Common vampire Bat IL-22 yeast-derived recombinant protein can be purchased in multiple sizes. Common vampire Bat IL-22 Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: ALPIGSHCRL DKSNFQQPYI TNHTFMLANE ASLADNNTDV RLIGEKLFRG VNMSEHCYLM KQVLNFIVEE VLLPESDRFQ PYMQEVVPFM ARLSNNLSQC RIESGDQHIR RNVQQLKDTV EKLGESGKIK AIGEVNLLFM FLRNACI (147)) (Gene ID: 112319158). For research use only. Made in the USA
The Jamaican fruit-eating Bat IL-2 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat IL-2 applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat IL-2 yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat IL-2 Specifications: (Molecular Weight: 15.4 kDa) (Amino Acid Sequence: APTSGSSRDT RQKLVDIKED LEKLLNGVNN YKNHEHSTML TFKFYTPRKV TELKHLLCLT DELNPLKDVL NLTQRKNFHL EEMARSVGNI NVTVNALVES TAETPCEYDD ETVTFVEFLN KWVTFCQSIF STLT (134)) (Gene ID: 119037638). For research use only. Made in the USA
Inserisci la tua e-mail e seleziona le aree di interesse per ricevere le ultime novità, approfondimenti e promozioni.
Seleziona uno o più ambiti di interesse per ricevere comunicazioni più utili e mirate.
2025 TEMA Ricerca - All Rights Reserved.
