YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ
β-galactosidase can catalyze the substrate nitrophenylgalactoside pyranopyranoside to produce nitrophenol, which has a maximum absorption peak at 400 nm. The activity of β-GAL can be calculated by measuring the OD value at 400 nm.
β-glucosidase (β-GC), also known as β-glucoside hydrolase, can efficiently hydrolyze the terminal non-reducing β-D-glucoside bonds in various glycoside compounds, thereby releasing β-D-glucose and corresponding ligands. The enzyme is widely present in nature, including the seeds of various plants, the small intestine and other organs of animals, and microorganisms. β-GC is a very important industrial enzyme with various applications. In the field of medicine, β-GC catalyzes the degradation of glycoside groups to inhibit the expansion of cancer cells. In terms of diet, β-GC catalyzes the production of anti-cancer molecules isoflavones in soybean. In the energy field, β-GC is one of the key enzymes in the conversion of cellulose to glucose. β-GC catalyzed the reaction of substrate to produce chromogenic substances at the wavelength of 400 nm, the maximum absorption of β-GC enzyme activity was reflected by measuring the OD value at 400 nm.
β- hydroxybutyrate dehydrogenase can catalyze the oxidative dehydrogenation of β-HB. Meanwhile, NAD+ is reduced to NADH, Which under the action of hydrogen transmitter, transfer electrons to WST-8 to produce the yellow product. The content of β-HB can be calculated by measuring the change of absorbance value at 450 nm.
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
