TEMA RICERCA

Home

Descrizione	Azione
C111H175N35O21 ACTH (6-24), human Codice: 5-00606 Confezionamento: 4 x 1mg	Dettagli
HFRWGKPVGKKRRPVKVYP ACTH (6-24), human Codice: E-PP-0605_10mg Confezionamento: 10mg	Dettagli
HFRWGKPVGKKRRPVKVYP ACTH (6-24), human Codice: E-PP-0605_5mg Confezionamento: 5mg	Dettagli
HFRWGKPVGKKRRPVKVYP ACTH (6-24), human Codice: E-PP-0605_5mg Confezionamento: 5mg	Dettagli
C167H257N47O46 ACTH (7- 38), human Codice: 5-00607 Confezionamento: 4 x 1mg	Dettagli
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE ACTH (7-38), human Codice: E-PP-0606_5mg Confezionamento: 5mg	Dettagli
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE ACTH (7-38), human Codice: E-PP-0606_5mg Confezionamento: 5mg	Dettagli
FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE ACTH (7-38), human Codice: E-PP-0606_10mg Confezionamento: 10mg	Dettagli
Adrenocorticotropin(ACTH) is a polypeptide hormone secreted by anterior pituitary cells, which is mainly used for functional classification of pituitary tumors and differential judging of primary and metastatic pituitary tumors. It can also be used to detect the distribution of hormone cells in some neuroendocrine tumors such as pheochromocytoma and carcinoid. ACTH Monoclonal Antibody Codice: ELAB6001-M_1mL Confezionamento: 1mL	Dettagli
Adrenocorticotropin(ACTH) is a polypeptide hormone secreted by anterior pituitary cells, which is mainly used for functional classification of pituitary tumors and differential judging of primary and metastatic pituitary tumors. It can also be used to detect the distribution of hormone cells in some neuroendocrine tumors such as pheochromocytoma and carcinoid. ACTH Monoclonal Antibody Codice: ELAB6001-M_0.2ml Confezionamento: 0.2ml	Dettagli
Adrenocorticotropin(ACTH) is a polypeptide hormone secreted by anterior pituitary cells, which is mainly used for functional classification of pituitary tumors and differential judging of primary and metastatic pituitary tumors. It can also be used to detect the distribution of hormone cells in some neuroendocrine tumors such as pheochromocytoma and carcinoid. ACTH Monoclonal Antibody Codice: ELAB6001-M_0.1ml Confezionamento: 0.1ml	Dettagli
Adrenocorticotropin(ACTH) is a polypeptide hormone secreted by anterior pituitary cells, which is mainly used for functional classification of pituitary tumors and differential judging of primary and metastatic pituitary tumors. It can also be used to detect the distribution of hormone cells in some neuroendocrine tumors such as pheochromocytoma and carcinoid. ACTH Monoclonal Antibody Codice: PA6001_1.5ml Confezionamento: 1.5ml	Dettagli

1…232 233 234235236 237 238…19204

Marca

Confezionamento

Conservazione

Specie target

Host

Concentrazione

Isotipo

Clonalità

Clone

Coniugazione

Detection range

Metodo di rilevazione

Tipo di campione

Tipo di saggio

Confezionamento (campo)

Data di scadenza

Applicazione

Diluizione

Sensibilità

Simbolo target

IG target

Etichetta

ID gene

Area di ricerca

Note applicative

Reset

2025 TEMA Ricerca - All Rights Reserved.