The Bovine IL-18 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-18 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-18 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-18 Specifications: (Molecular Weight: 18.1 kDa) (Amino Acid Sequence: HFGKLEPKLS IIRNLNDQVL FINQGNQPVF EDMPDSDCSD NAPQTIFIIY MYKDSLTRGL AVTISVQCKK MSTLSCENKI VSFKEMNPPD NIDNEESDII FFQRSVPGHD DKIQFESSLY EGYFLACKKE NDLFKLILKK QDDNRDKSVM FTVQNQN (157)) (Gene ID: 281249). For research use only. Made in the USA
The Bovine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 alpha Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: SNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK) (Gene ID: 281250). For research use only. Made in the USA
The Bovine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta Biotinylated applications are for cell culture. Bovine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251). For research use only. Made in the USA
The Bovine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 beta Specifications: (Molecular Weight: 17.7 kDa) (Amino Acid Sequence: APVQSIKCKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP) (Gene ID: 281251). For research use only. Made in the USA
The Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-36 Receptor Antagonist Biotinylated applications are for cell culture. Bovine IL-36 Receptor Antagonist Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-36 Receptor Antagonist Biotinylated Specifications: (Molecular Weight: 17.1 kDa) (Amino Acid Sequence: MVLSGALCFRMKDAALKVLYLHDNQLLAGGLQAGKVIKGEEISVVPNRSLDAKLSPVILGVHGGSQCLSCGTGQEPTLKLEPVNIMELYHSAEKSKKFTFYRRDTGLTSSFESAAYPGWFLCTVPEADQPLQITQLPKDTSWDNPIIDFYFQQCD) (Gene ID: 518514). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
