The Bovine TNF alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine TNF alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine TNF alpha yeast-derived recombinant protein can be purchased in multiple sizes. Bovine TNF alpha Specifications: (Molecular Weight: 17.4 kDa) (Amino Acid Sequence: LRSSSQASSN KPVAHVVADI NSPGQLRWWD SYANALMANG VKLEDNQLVV PADGLYLIYS QVLFRGQGCP STPLFLTHTI SRIAVSYQTK VNILSAIKSP CHRETPEWAE AKPWYEPIYQ GGVFQLEKGD RLSAEINLPD YLDYAESGQV YFGIIAL) (Gene ID: 280943). For research use only. Made in the USA
The Bovine TSLP yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine TSLP applications are for cell culture, ELISA Standard, ELISpot Control, and Western Blot Control. Bovine TSLP yeast-derived recombinant protein can be purchased in multiple sizes. Bovine TSLP Specifications: (Molecular Weight:14.8 kDa) (Amino Acid Sequence:YNFTDCDFKK IKESYRNIIY QELNNYTKGT KAIDFDHFVY CEDQPDCLSK IQSLTFEGRP GCAAPAREAF AVRTHAALAA ACPGYRGPQI NNTQTMRKIR KRQIKRKECL EQVTYLKELW QRLSRIS). For research use only. Made in the USA.
The Bovine VEGF-A Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A Biotinylated applications are for cell culture. Bovine VEGF-A Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Biotinylated Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). For research use only. Made in the USA
The Bovine VEGF-A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine VEGF-A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine VEGF-A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine VEGF-A Specifications: (Molecular Weight: 19.2 kDa) (Amino Acid Sequence: APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR) (Gene ID: 281572). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
