Recombinant Proteins

Descrizione Azione

The Canine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 alpha Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)) (Gene ID: 403782). For research use only. Made in the USA

Codice: RP0486D-100
Dettagli

The Canine IL-1 alpha yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 alpha applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 alpha yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 alpha Specifications: (Molecular Weight: 18.2 kDa) (Amino Acid Sequence: SVAYNFHNNE KYNYIRIIKS QFILNDNLNQ SIVRQTGGNY LMTAALQNLD DAVKFDMGAY TSEDSKLPVT LRISKTRLFV SAQNEDEPVL LKEMPETPKT IRDETNLLFF WERHGSKHYF KSVAQPKLFI ATQERKLVHM ARGQPSITDF RLLETQP (157)) (Gene ID: 403782). For research use only. Made in the USA

Codice: RP0486D-025
Dettagli

The Canine IL-1 beta Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta Biotinylated applications are for cell culture. Canine IL-1 beta Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Biotinylated Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA

Codice: RPB1839D-010
Dettagli

The Canine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA

Codice: RP0085D-005
Dettagli

The Canine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA

Codice: RP0085D-500
Dettagli

The Canine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA

Codice: RP0085D-025
Dettagli

The Canine IL-1 beta yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 beta applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 beta yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 beta Specifications: (Molecular Weight: 17.5 kDa) (Amino Acid Sequence: AAMQSVDCKLQDISHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNLYLSCVMKDGKPTLQLEKVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQVEGMPVFLGNTRGGQDITDFTMEFSS) (Gene ID: 403974). For research use only. Made in the USA

Codice: RP0085D-100
Dettagli

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). For research use only. Made in the USA

Codice: RP0427D-005
Dettagli

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). For research use only. Made in the USA

Codice: RP0427D-100
Dettagli

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). For research use only. Made in the USA

Codice: RP0427D-500
Dettagli

The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-1 Receptor Antagonist applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-1 Receptor Antagonist yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-1 Receptor Antagonist Specifications: (Molecular Weight: 16.8 kDa) (Amino Acid Sequence: LGKRPCRMQAFRIWDVNQKTFYLRNNQLVAGYLQGSNTKLEEKLDVVPVEPHAVFLGIHGGKLCLACVKSGDETRLQLEAVNITDLSKNKDQDKRFTFILSDSGPTTSFESAACPGWFLCTALEADRPVSLTNRPEEAMMVTKFYFQKE (149)) (Gene ID: 403660). For research use only. Made in the USA

Codice: RP0427D-025
Dettagli

The Canine IL-21 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-21 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-21 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-21 Specifications: (Molecular Weight: 14.9 kDa) (Amino Acid Sequence: HKSSFQEQDL LLIRMRQLID IVDQLKNYVN DLDPESLPAP EDVKRHCERS AFSCFQKVQL KAANTGGNEQ IINVLTKQLK RKLPPTNAGR RQKHRPACPS CDSYEKAPPK EFLERLKSLI QKMIHQHLS (129)) (Gene ID: 442935). For research use only. Made in the USA

Codice: RP0256D-005
Dettagli