The Equine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDAVSIPVT CCFGVVKKKV PIQRLESYTR ITSSQCSQEA VIFKTKVDKE ICADPKQKWV QDTMKRLDQR SQTPK (75)) (Gene ID: 100033927). For research use only. Made in the USA
The Equine CD40 Ligand yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CD40 Ligand applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CD40 Ligand yeast-derived recombinant protein can be purchased in multiple sizes. Equine CD40 Ligand Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: MQKGDQEPQI AAHVISEASS KTASVLQWAQ KGYYTISNNL VTLENGKQLA VKRQGLYYIY AQVTFCSNRE ASGQAPFIAS LCLRSVSGSE RILLRAANTH SSSKPCGQQS IHLGGVFELQ PGASVFVNVT DPSQVSHGTG FTSFGLLKL (149)) (Gene ID: 100054624). For research use only. Made in the USA
The Equine CXCL10 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL10 applications are for cell culture, ELISA standard, and Western Blot Control. The Equine CXCL10 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL10 Specifications: (Molecular Weight: 9.4 kDa) (Amino Acid Sequence: IPLSRTARCTCINISDRPIPPRSLEKLEMIPASQSCQRVEIIATMKKNGEKRCLNPESKTVKNLLKAISKQRSKRSPRTLREV) (Gene ID: 100050993). For research use only. Made in the USA
The Equine CXCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL13 Specifications: (Molecular Weight: 10.0 kDa) (Amino Acid Sequence: VLEAYNTNLK CKCIQHTSFF FPIRHIDRVQ IVSPGNGCPN MEVIIWLKNK SVVCLNPKAK STKKLMNVLW RKTFPSTPPT PVSKSMTT (88)) (Gene ID: 100629997). For research use only. Made in the USA
The Equine CXCL3 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine CXCL3 applications are for cell culture, ELISA standard, and Western Blot Control. Equine CXCL3 yeast-derived recombinant protein can be purchased in multiple sizes. Equine CXCL3 Specifications: (Molecular Weight: 7.8 kDa) (Amino Acid Sequence: APVVSELRCQ CLQTVQGIHQ KNIQSVKVTP AGSHCAQTEV IATLKNGQKA CLNPAAPMVK KMIDRMLNKG STN (73)) (Gene ID: 100056258). For research use only. Made in the USA
Lascia la tua email e seleziona le aree che vuoi seguire per ricevere novita di prodotto, approfondimenti tecnici e promozioni piu pertinenti.
Puoi scegliere le macro-aree Life Science e Diagnostica oppure le singole specializzazioni.
Seleziona uno o piu ambiti di interesse per ricevere comunicazioni piu utili e mirate.
Aggiornamenti su ricerca, strumentazione e applicazioni per il mondo Life Science.
Novita, approfondimenti e promozioni per laboratori diagnostici e flussi operativi.
2025 TEMA Ricerca - All Rights Reserved.
